跳至主要内容

Catalpol provides a protective effect on fibrillary Aβ1–42induced barrier disruption in an in vitro model of the blood–brain barrier

文献作者:Chenyang Liu, Kang Chen, Yunwei Lu, Zhuyuan Fang, Guran Yu   《Phytotherapy Research》


ABSTRACTS
Excessive amyloid beta (Aβ) deposition in brain is mainly responsible for cell damage and blood–brain barrier (BBB) disruption in Alzheimer's disease (AD). Catalpol, an iridoid glucoside extracted from the root of Rehmannia glutinosa Libosch, has neuroprotective effect against AD. It is unclear whether catalpol has a protective effect on Aβinduced BBB leakage. We employed an immortalized endothelial cell line (bEnd.3) and astrocytes coculture to mimic a BBB model in vitro and investigated the effect of catalpol on BBB. We found that treatment with catalpol decreased BBB hyperpermeability induced by fibrillar Aβ1–42. Data from western blotting showed that catalpol prevented fibrillar Aβ1–42induced bEnd.3 cell apoptosis through mitochondriadependent and death receptor pathways; decreased the levels of matrix metalloproteinases (MMPs), MMP2, MMP9, and the receptor for advanced glycation end products; and increased the levels of tight junction proteins (ZO1, occludin, and claudin5), lowdensity lipoprotein receptorrelated protein 1, and Pglycoprotein in fibrillar Aβ1–42treated bEnd.3 cells. Moreover, catalpol also enhanced soluble Aβ efflux across the fibrillar Aβ1–42treated bEnd.3 cells BBB monolayer model. Altogether, our results suggest that catalpol alleviate fibrillar Aβ1–42induced BBB disruption, enhance soluble Aβ clearance, and offer a feasible therapeutic application in AD treatment.
SCREENSHOT

RELATED PRODUCTS
Lyophilized rat Aβ1–42 (95% purity) was purchased from ChinaPeptides Co. Ltd (Shanghai, China).
CHAINING
https://onlinelibrary.wiley.com/doi/abs/10.1002/ptr.6043

Number of Residues:42
1-Letter Code:DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
3-Letter Code:Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala

Molecular weight (Mr):4418.01 g/mol
Isoelectric point:4.7
Net charge at pH 7.0:-2.8
Average hydrophilicity:-0.1
Ratio of hydrophilic residues / total number of residues:31 %

评论

此博客中的热门博文

The Catalytically Inactive Mutation of the Ubiquitin-Conjugating Enzyme CDC34 Affects its Stability and Cell Proliferation

Author:Xun Liu, Yang Zhang, Zhanhong Hu, Qian Li, Lu Yang,  Guoqiang Xu     《The Protein Journal》 ABSTRACTS The ubiquitin proteasome system (UPS) plays important roles in the regulation of protein stability, localization, and activity. A myriad of studies have focused on the functions of ubiquitin ligases E3s and deubiquitinating enzymes DUBs due to their specificity in the recognition of downstream substrates. However, the roles of the most ubiquitin-conjugating enzymes E2s are not completely understood except that they transport the activated ubiquitin and form E2–E3 protein complexes. Ubiquitin-conjugating enzyme CDC34 can promote the degradation of downstream targets through the UPS whereas its non-catalytic functions are still elusive. Here, we find that mutation of the catalytically active cysteine to serine (C93S) results in the reduced ubiquitination, increased stability, and attenuated degradation rate of CDC34. Through semi-quantitative proteom...

Identification and Inhibitory Mechanism of Angiotensin I-Converting Enzyme Inhibitory Peptides Derived from Bovine Hemoglobin

Author:Ying Wang, Yiqun Jiang, Yongguang Yin, Jiyun Liu,  Long Ding, Jingbo Liu, Ting Zhang     《The Protein Journal》 ABSTRACTS Angiotensin I-converting enzyme (ACE, EC.3.4.15.1) inhibitory peptide is an efficacious therapy for hypertension. In this study, four dipeptides, TY, FD, FL and FG, were identified from the desalted fraction of bovine hemoglobin hydrolysate, obtained by in vitro simulated gastrointestinal digestion, via liquid chromatography-tandem mass spectrometry (LC-MS/MS). The IC 50   value of TY and FL are 96.43?±?6.17 and 290.66?±?57.92  μM, respectively. The result of molecular docking indicated that TY occupied the ACE subsite S1 and S1′ with a lowest estimated binding energy of ?9.96  Kcal/mol, while FL occupied the subsite S5 with a lowest estimated binding energy of ?9.37  Kcal/mol. The subsite S1′ and S2′ are closer to the ACE active center (Zn 2+ ) than S5, and the lowest estimated binding energy of TY is lower ...

Preparation of an antimicrobial surface by direct assembly of antimicrobial peptide with its surface binding activity

Author:Junjian Chen, Yuchen Zhu, Yancheng Song, Lin Wang,  Jiezhao Zhan, Jingcai He, Jian Zheng, Chunting Zhong, Xuetao Shi, Sa Liu, Li Ren and Yingjun Wang     《Journal of Materials Chemistry B》 ABSTRACTS Antimicrobial peptides (AMPs) are a broad prospect for clinical application against bacterial infections of biomaterials. However, a bottleneck exists as there is a lack of simple technology to prepare AMPs on biomaterials with sufficient activity, as the activity of AMP is dependent on the correct orientation on the biomaterial. In the present study, based on the conventional AMP (Tet213: KRWWKWWRRC) and surface binding peptide (SKHKGGKHKGGKHKG), we designed an Anchor-AMP that could be directly assembled onto the surface of the biomaterial and also showed excellent antimicrobial activity. By characterizing the surface using a quartz crystal microbalance with dissipation (QCM-D), contact angle, atom force microscopy (AFM) and X-ray photoelectron spectr...